2h0e/2/5:B/7:B

Sequences
>2h0e-a2-m5-cB (length=109) [Search sequence]
GKLTTHILDLTCGKPAANVKIGLKRLGESIKEVYTNNDGRVDVPLLAGEELSGEYVEFHA
GDYFASKNNAADQPFLTIVTVRFQLADPDAHYHIPLLLSPFGYQVYRGS
>2h0e-a2-m7-cB (length=109) [Search sequence]
GKLTTHILDLTCGKPAANVKIGLKRLGESIKEVYTNNDGRVDVPLLAGEELSGEYVEFHA
GDYFASKNNAADQPFLTIVTVRFQLADPDAHYHIPLLLSPFGYQVYRGS
Structure information
PDB ID 2h0e (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of PucM in the absence of substrate
Assembly ID 2
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 70
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 5 7
Chain ID B B
UniProt accession O32142 O32142
Species 1423 (Bacillus subtilis) 1423 (Bacillus subtilis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2h0e-a2-m5-cB_2h0e-a2-m7-cB.pdb.gz
Full biological assembly
Download: 2h0e-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2h0e/1/1:A/2:A 2h0e/1/3:A/4:A 2h0e/2/1:B/6:B 2h0f/1/1:A/2:A 2h0f/1/3:A/4:A 2h0f/2/1:B/6:B 2h0f/2/5:B/7:B 2h0j/1/1:A/2:A 2h0j/1/3:A/4:A 2h0j/2/1:B/6:B 2h0j/2/5:B/7:B
Other dimers with similar sequences but different poses
  • 2h0j/2/1:B/7:B 2h0e/1/1:A/3:A 2h0e/1/2:A/4:A 2h0e/2/1:B/7:B 2h0e/2/5:B/6:B 2h0f/1/1:A/3:A 2h0f/1/2:A/4:A 2h0f/2/1:B/7:B 2h0f/2/5:B/6:B 2h0j/1/1:A/3:A 2h0j/1/2:A/4:A 2h0j/2/5:B/6:B
  • 2h0j/2/6:B/7:B 2h0e/1/1:A/4:A 2h0e/1/2:A/3:A 2h0e/2/1:B/5:B 2h0e/2/6:B/7:B 2h0f/1/1:A/4:A 2h0f/1/2:A/3:A 2h0f/2/1:B/5:B 2h0f/2/6:B/7:B 2h0j/1/1:A/4:A 2h0j/1/2:A/3:A 2h0j/2/1:B/5:B
    		•

    [Back to Home]