2h4o/1/2:B/2:D

Sequences
>2h4o-a1-m2-cB (length=60) [Search sequence]
ASKKVHQINVKGFFDDVEVTEQTKEAEYTYDFKEILSEFNGKNVSITVKEENELPVKGVE
>2h4o-a1-m2-cD (length=60) [Search sequence]
ASKKVHQINVKGFFDDVEVTEQTKEAEYTYDFKEILSEFNGKNVSITVKEENELPVKGVE
Structure information
PDB ID 2h4o (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-ray Crystal Structure of Protein yonK from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR415
Assembly ID 1
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID B D
UniProt accession O31947 O31947
Species 1423 (Bacillus subtilis) 1423 (Bacillus subtilis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2h4o-a1-m2-cB_2h4o-a1-m2-cD.pdb.gz
Full biological assembly
Download: 2h4o-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2h4o/1/1:A/1:B 2h4o/1/1:A/2:C 2h4o/1/1:B/1:D 2h4o/1/1:C/2:A 2h4o/1/1:C/2:D 2h4o/1/1:D/2:C 2h4o/1/2:A/2:B
Other dimers with similar sequences but different poses
  • 2h4o/1/1:B/2:D 2h4o/1/1:A/1:C 2h4o/1/1:D/2:B 2h4o/1/2:A/2:C
  • 2h4o/1/1:D/2:D 2h4o/1/1:A/2:A 2h4o/1/1:B/1:C 2h4o/1/2:B/2:C
    		•

    [Back to Home]