2h6u/1/1:A/1:C

Sequences
>2h6u-a1-m1-cA (length=114) [Search sequence]
LSPLSTHVLNIAQGVPGANMTIVLHRLDPVSSAWNILTTGITNDDGRCPGLITKENFIAG
VYKMRFETGKYWDALGETCFYPYVEIVFTITNTSQHYHVPLLLSRFSYSTYRGS
>2h6u-a1-m1-cC (length=114) [Search sequence]
LSPLSTHVLNIAQGVPGANMTIVLHRLDPVSSAWNILTTGITNDDGRCPGLITKENFIAG
VYKMRFETGKYWDALGETCFYPYVEIVFTITNTSQHYHVPLLLSRFSYSTYRGS
Structure information
PDB ID 2h6u (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of 5-hydroxyisourate hydrolase (formerly known as TRP, transthyretin related protein)
Assembly ID 1
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 31
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession Q06S87 Q06S87
Species 7955 (Danio rerio) 7955 (Danio rerio)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2h6u-a1-m1-cA_2h6u-a1-m1-cC.pdb.gz
Full biological assembly
Download: 2h6u-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2h1x/1/1:A/1:D 2h1x/1/1:B/1:C 2h6u/1/1:B/1:D 2h6u/2/1:E/1:G 2h6u/2/1:F/1:H 3iwu/1/1:A/1:C 3iwu/1/1:B/1:D 3iwu/2/1:E/1:G 3iwu/2/1:F/1:H 3iwv/1/1:A/1:D 3iwv/1/1:B/1:C 3q1e/1/1:A/1:D 3q1e/1/1:B/1:C
Other dimers with similar sequences but different poses
  • 2h6u/1/1:C/1:D 2h1x/1/1:A/1:B 2h1x/1/1:C/1:D 2h6u/1/1:A/1:B 2h6u/2/1:E/1:F 2h6u/2/1:G/1:H 3iwu/1/1:A/1:B 3iwu/1/1:C/1:D 3iwu/2/1:E/1:F 3iwu/2/1:G/1:H 3iwv/1/1:A/1:B 3iwv/1/1:D/1:C 3q1e/1/1:A/1:B 3q1e/1/1:C/1:D
  • 2h6u/1/1:A/1:D 2h1x/1/1:A/1:C 2h1x/1/1:B/1:D 2h6u/1/1:B/1:C 2h6u/2/1:E/1:H 2h6u/2/1:F/1:G 3iwu/1/1:A/1:D 3iwu/1/1:B/1:C 3iwu/2/1:E/1:H 3iwu/2/1:F/1:G 3iwv/1/1:A/1:C 3iwv/1/1:D/1:B 3q1e/1/1:A/1:C 3q1e/1/1:B/1:D
  • [Back to Home]