2h8n/1/1:A/1:C

Sequences
>2h8n-a1-m1-cA (length=68) [Search sequence]
AEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAM
KHQQELLE
>2h8n-a1-m1-cC (length=68) [Search sequence]
AEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAM
KHQQELLE
Structure information
PDB ID 2h8n (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of a glutamine-rich domain from histone deacetylase 4
Assembly ID 1
Resolution 2.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 55
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession P56524 P56524
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2h8n-a1-m1-cA_2h8n-a1-m1-cC.pdb.gz
Full biological assembly
Download: 2h8n-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2h8n/1/1:B/1:D 2o94/1/1:A/1:C 2o94/1/1:B/1:D
Other dimers with similar sequences but different poses
  • 2h8n/1/1:C/1:D 2h8n/1/1:A/1:B 2o94/1/1:A/1:B 2o94/1/1:C/1:D
  • 2h8n/1/1:A/1:D 2h8n/1/1:B/1:C 2o94/1/1:A/1:D 2o94/1/1:B/1:C
  • [Back to Home]