2h9d/3/1:A/1:D

Sequences
>2h9d-a3-m1-cA (length=84) [Search sequence]
MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFERVAAMLPERARWAEENGL
DAPFVEGLFAQIIHWYIAEQIKYW
>2h9d-a3-m1-cD (length=100) [Search sequence]
MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKASEAAIPAPERVAAMLPE
RARWAEENGLDAPFVEGLFAQIIHWYIAEQIKYWRQTRGA
Structure information
PDB ID 2h9d (database links: RCSB PDB PDBe PDBj PDBsum)
Title Pyruvate-Bound Structure of the Isochorismate-Pyruvate Lyase from Pseudomonas aerugionsa
Assembly ID 3
Resolution 1.95Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 23
Sequence identity between the two chains 1.0
PubMed citation 16914555
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A D
UniProt accession Q51507 Q51507
Species 208964 (Pseudomonas aeruginosa PAO1) 208964 (Pseudomonas aeruginosa PAO1)
Function annotation BioLiP:2h9dA BioLiP:2h9dD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2h9d-a3-m1-cA_2h9d-a3-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2h9d-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2h9d/4/2:A/2:B 2h9c/1/1:B/1:A 2h9c/2/1:B/1:A 2h9c/2/2:B/2:A 2h9d/1/1:A/1:B 2h9d/3/1:A/1:B 3hgw/1/1:C/1:D
  • 2h9d/3/1:A/1:C 2h9c/2/1:A/2:A
    		•

    [Back to Home]