2h9d/4/1:C/1:D

Sequences

>2h9d-a4-m1-cC (length=98) [Search sequence]

MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKASEAAIPAPERVAAMLPE RARWAEENGLDAPFVEGLFAQIIHWYIAEQIKYWRQTR

>2h9d-a4-m1-cD (length=100) [Search sequence]

MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKASEAAIPAPERVAAMLPE RARWAEENGLDAPFVEGLFAQIIHWYIAEQIKYWRQTRGA

Structure information

PDB ID	2h9d (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Pyruvate-Bound Structure of the Isochorismate-Pyruvate Lyase from Pseudomonas aerugionsa
Assembly ID	4
Resolution	1.95Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	126
Sequence identity between the two chains	1.0
PubMed citation	16914555

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q51507	Q51507
Species	208964 (Pseudomonas aeruginosa PAO1)	208964 (Pseudomonas aeruginosa PAO1)
Function annotation	BioLiP:2h9dC	BioLiP:2h9dD

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2h9d-a4-m1-cC_2h9d-a4-m1-cD.pdb.gz

Full biological assembly Download: 2h9d-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2h9d/2/1:C/1:D 2h9d/3/1:C/1:D 3hgx/1/1:A/1:B 3rem/1/1:A/1:B 3ret/1/1:B/1:A
Other dimers with similar sequences but different poses	2h9d/3/1:B/1:C 2h9c/2/1:B/2:A 2h9d/3/1:B/1:D 2h9c/2/1:B/2:B