2h9d/4/2:A/2:B

Sequences

>2h9d-a4-m2-cA (length=84) [Search sequence]

MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFERVAAMLPERARWAEENGL DAPFVEGLFAQIIHWYIAEQIKYW

>2h9d-a4-m2-cB (length=87) [Search sequence]

KTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFIPAPERVAAMLPERARWAEE NGLDAPFVEGLFAQIIHWYIAEQIKYW

Structure information

PDB ID	2h9d (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Pyruvate-Bound Structure of the Isochorismate-Pyruvate Lyase from Pseudomonas aerugionsa
Assembly ID	4
Resolution	1.95Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	126
Sequence identity between the two chains	0.988
PubMed citation	16914555

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	A	B
UniProt accession	Q51507	Q51507
Species	208964 (Pseudomonas aeruginosa PAO1)	208964 (Pseudomonas aeruginosa PAO1)
Function annotation	BioLiP:2h9dA	BioLiP:2h9dB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2h9d-a4-m2-cA_2h9d-a4-m2-cB.pdb.gz

Full biological assembly Download: 2h9d-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2h9c/1/1:B/1:A 2h9c/2/1:B/1:A 2h9c/2/2:B/2:A 2h9d/1/1:A/1:B 2h9d/3/1:A/1:B 3hgw/1/1:C/1:D
Other dimers with similar sequences but different poses	2h9d/3/1:A/1:C 2h9c/2/1:A/2:A 2h9d/3/1:A/1:D 2h9c/2/2:B/1:A