2hba/3/3:A/4:A

Sequences
>2hba-a3-m3-cA (length=52) [Search sequence]
MKVIFLKDVKGMGKKGEIKNVADGYANNFLFKQGLAIEATPANLKALEAQKQ
>2hba-a3-m4-cA (length=52) [Search sequence]
MKVIFLKDVKGMGKKGEIKNVADGYANNFLFKQGLAIEATPANLKALEAQKQ
Structure information
PDB ID 2hba (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of N-terminal Domain of Ribosomal Protein L9 (NTL9) K12M
Assembly ID 3
Resolution 1.25Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 17
Sequence identity between the two chains 1.0
PubMed citation 25099351
Chain information
Chain 1 Chain 2
Model ID 3 4
Chain ID A A
UniProt accession P02417 P02417
Species 1422 (Geobacillus stearothermophilus) 1422 (Geobacillus stearothermophilus)
Function annotation BioLiP:2hbaA BioLiP:2hbaA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2hba-a3-m3-cA_2hba-a3-m4-cA.pdb.gz
Full biological assembly
Download: 2hba-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2hba/3/1:B/4:A 2hba/3/2:B/3:A
  • 2hvf/2/1:A/2:A 2hbb/2/1:A/2:A
    		•

    [Back to Home]