2hci/1/1:B/1:A

Sequences

>2hci-a1-m1-cB (length=65) [Search sequence]

DCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLS KKVKN

>2hci-a1-m1-cA (length=68) [Search sequence]

SNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVR LLSKKVKN

Structure information

PDB ID	2hci (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of Human Mip-3a Chemokine
Assembly ID	1
Resolution	1.81Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	52
Sequence identity between the two chains	1.0
PubMed citation	16820679

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	P78556	P78556
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:2hciA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2hci-a1-m1-cB_2hci-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2hci-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

5ur7/1/1:A/1:B 7t1e/1/1:B/1:A 7t1e/2/1:C/1:D