2hfn/1/1:G/1:I

Sequences
>2hfn-a1-m1-cG (length=139) [Search sequence]
SLYRLIYSSQGIPNLQPQDLKDILESSQRNNPANGITGLLCYSKPAFLQVLEGECEQVNE
TYHRIVQDERHHSPQIIECMPIRRRNFEVWSMQAITVNDLSTEQVKTLVLKYSGFTTLRP
SAMDPEQCLNFLLDIAKIY
>2hfn-a1-m1-cI (length=139) [Search sequence]
SLYRLIYSSQGIPNLQPQDLKDILESSQRNNPANGITGLLCYSKPAFLQVLEGECEQVNE
TYHRIVQDERHHSPQIIECMPIRRRNFEVWSMQAITVNDLSTEQVKTLVLKYSGFTTLRP
SAMDPEQCLNFLLDIAKIY
Structure information
PDB ID 2hfn (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structures of the Synechocystis Photoreceptor Slr1694 Reveal Distinct Structural States Related to Signaling
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 32
Sequence identity between the two chains 1.0
PubMed citation 17042486
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID G I
UniProt accession P74295 P74295
Species 1143 (Synechocystis sp.) 1143 (Synechocystis sp.)
Function annotation BioLiP:2hfnG BioLiP:2hfnI
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2hfn-a1-m1-cG_2hfn-a1-m1-cI.pdb.gz
Full biological assembly
Download: 2hfn-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2hfn/1/1:B/1:D 2hfn/1/1:B/1:J 2hfn/1/1:C/1:A 2hfn/1/1:E/1:C 2hfn/1/1:E/1:G 2hfn/1/1:F/1:D 2hfn/1/1:F/1:H 2hfn/1/1:H/1:J 2hfn/1/1:I/1:A 2hfo/1/1:B/1:D 2hfo/1/1:C/1:A 2hfo/1/1:C/1:E 2hfo/1/1:F/1:D 2hfo/1/1:F/1:H 2hfo/1/1:G/1:E 2hfo/1/1:G/1:I 2hfo/1/1:I/1:A 2hfo/1/1:J/1:B 2hfo/1/1:J/1:H
Other dimers with similar sequences but different poses
  • 2hfn/1/1:E/1:F 2hfn/1/1:B/1:A 2hfn/1/1:C/1:D 2hfn/1/1:G/1:H 2hfn/1/1:I/1:J 2hfo/1/1:B/1:A 2hfo/1/1:C/1:D 2hfo/1/1:F/1:E 2hfo/1/1:G/1:H 2hfo/1/1:J/1:I 3mzi/1/1:A/1:B 3mzi/2/1:C/1:D 3mzi/3/1:E/1:F
  • [Back to Home]