2hj1/2/2:A/2:B

Sequences

>2hj1-a2-m2-cA (length=77) [Search sequence]

NQINIEIAYAFPERYYLKSFQVDEGITVQTAITQSGILSQFPEIDLSTNKIGIFSRPIKL TDVLKEGDRIEIYRPLL

>2hj1-a2-m2-cB (length=80) [Search sequence]

LNQINIEIAYAFPERYYLKSFQVDEGITVQTAITQSGILSQFPEIDLSTNKIGIFSRPIK LTDVLKEGDRIEIYRPLLAD

Structure information

PDB ID	2hj1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a 3D domain-swapped dimer of protein HI0395 from Haemophilus influenzae
Assembly ID	2
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	211
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	A	B
UniProt accession	Q4QNE7	Q4QNE7
Species	281310 (Haemophilus influenzae 86-028NP)	281310 (Haemophilus influenzae 86-028NP)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2hj1-a2-m2-cA_2hj1-a2-m2-cB.pdb.gz

Full biological assembly Download: 2hj1-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2hj1/1/1:A/1:B 2hj1/2/1:A/1:B
Other dimers with similar sequences but different poses	2hj1/2/1:A/2:B 2hj1/2/2:A/1:B