2hj3/3/1:A/2:A

Sequences
>2hj3-a3-m1-cA (length=101) [Search sequence]
PVTKEDLGRATWTFLHTLAAQYPEKPTRQQKKDVKELMTILSRMYPCRECADHFKEILRS
NPAQAGSQEEFSQWLCHVHNTVNRSLGKLVFPCERVDARWG
>2hj3-a3-m2-cA (length=101) [Search sequence]
PVTKEDLGRATWTFLHTLAAQYPEKPTRQQKKDVKELMTILSRMYPCRECADHFKEILRS
NPAQAGSQEEFSQWLCHVHNTVNRSLGKLVFPCERVDARWG
Structure information
PDB ID 2hj3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the Arabidopsis Thaliana Erv1 Thiol Oxidase
Assembly ID 3
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 1.0
PubMed citation 16893552
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q8GXX0 Q8GXX0
Species 3702 (Arabidopsis thaliana) 3702 (Arabidopsis thaliana)
Function annotation BioLiP:2hj3A BioLiP:2hj3A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2hj3-a3-m1-cA_2hj3-a3-m2-cA.pdb.gz
Full biological assembly
Download: 2hj3-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2hj3/3/2:B/2:A 2hj3/1/1:B/1:A 2hj3/3/1:B/1:A
  • 2hj3/2/4:B/2:A 2hj3/2/3:B/1:A
  • 2hj3/2/4:B/1:A 2hj3/2/3:B/2:A
  • [Back to Home]