2hnu/2/1:C/1:D

Sequences
>2hnu-a2-m1-cC (length=81) [Search sequence]
VRTCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGR
CAAAGICCSPDGCHEDPACDP
>2hnu-a2-m1-cD (length=81) [Search sequence]
VRTCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGR
CAAAGICCSPDGCHEDPACDP
Structure information
PDB ID 2hnu (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of a Dipeptide Complex of Bovine Neurophysin-I
Assembly ID 2
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 49
Sequence identity between the two chains 1.0
PubMed citation 17192588
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession P01175 P01175
Species 9913 (Bos taurus) 9913 (Bos taurus)
Function annotation BioLiP:2hnuC BioLiP:2hnuD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2hnu-a2-m1-cC_2hnu-a2-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2hnu-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2hnu/1/1:A/1:B 2hnu/3/1:E/2:E 2hnv/1/1:A/1:B 2hnv/2/1:C/1:D 2hnv/3/1:E/2:E 2hnw/1/1:A/1:B 2hnw/2/1:C/1:D 2hnw/3/1:E/2:E 2lbh/1/1:A/1:B

[Back to Home]