2hsq/3/12:A/6:A

Sequences
>2hsq-a3-m12-cA (length=261) [Search sequence]
MEHHHHHHMPVFHTRTIESILEPVAQQISHLVIMHEEKAIPDLTAPVAAVQAAVSNLVRV
GKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILS
GTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDE
RQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKM
SAEINEIIRVLQLTSWDEDAW
>2hsq-a3-m6-cA (length=261) [Search sequence]
MEHHHHHHMPVFHTRTIESILEPVAQQISHLVIMHEEKAIPDLTAPVAAVQAAVSNLVRV
GKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILS
GTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDE
RQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKM
SAEINEIIRVLQLTSWDEDAW
Structure information
PDB ID 2hsq (database links: RCSB PDB PDBe PDBj PDBsum)
Title Human vinculin (head domain, Vh1, residues 1-258) in complex with Shigella's IpaA vinculin binding site 2 (residues 565-587)
Assembly ID 3
Resolution 3.97Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 36
Sequence identity between the two chains 1.0
PubMed citation 17088427
Chain information
Chain 1 Chain 2
Model ID 12 6
Chain ID A A
UniProt accession P18206 P18206
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:2hsqA BioLiP:2hsqA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2hsq-a3-m12-cA_2hsq-a3-m6-cA.pdb.gz
Full biological assembly
Download: 2hsq-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1syq/2/1:A/2:A 1syq/2/1:A/3:A 1syq/2/2:A/3:A 1syq/2/4:A/5:A 1syq/2/4:A/6:A 1syq/2/5:A/6:A 1syq/3/1:A/2:A 1syq/3/1:A/3:A 1syq/3/2:A/3:A 1syq/3/7:A/8:A 1syq/3/7:A/9:A 1syq/3/8:A/9:A 2gww/2/1:A/2:A 2gww/2/1:A/3:A 2gww/2/2:A/3:A 2gww/2/4:A/5:A 2gww/2/4:A/6:A 2gww/2/5:A/6:A 2gww/3/1:A/2:A 2gww/3/1:A/3:A 2gww/3/2:A/3:A 2hsq/2/10:A/4:A 2hsq/2/10:A/5:A 2hsq/2/11:A/3:A 2hsq/2/11:A/7:A 2hsq/2/12:A/6:A 2hsq/2/13:A/18:A 2hsq/2/13:A/24:A 2hsq/2/14:A/20:A 2hsq/2/14:A/21:A 2hsq/2/15:A/19:A 2hsq/2/15:A/23:A 2hsq/2/16:A/17:A 2hsq/2/16:A/22:A 2hsq/2/17:A/22:A 2hsq/2/18:A/24:A 2hsq/2/19:A/23:A 2hsq/2/1:A/12:A 2hsq/2/1:A/6:A 2hsq/2/20:A/21:A 2hsq/2/2:A/8:A 2hsq/2/2:A/9:A 2hsq/2/3:A/7:A 2hsq/2/4:A/5:A 2hsq/2/8:A/9:A 2hsq/3/1:A/12:A 2hsq/3/1:A/6:A 2hsq/3/25:A/26:A 2hsq/3/25:A/27:A 2hsq/3/26:A/27:A
Other dimers with similar sequences but different poses
  • 1syq/2/3:A/6:A 1syq/2/1:A/5:A 1syq/2/2:A/4:A
  • 2hsq/3/26:A/6:A 1syq/3/1:A/7:A 1syq/3/2:A/9:A 1syq/3/3:A/8:A 2gww/2/1:A/4:A 2gww/2/2:A/6:A 2gww/2/3:A/5:A 2hsq/3/12:A/25:A 2hsq/3/1:A/27:A
  • 1syq/3/1:A/9:A 1syq/3/2:A/8:A 1syq/3/3:A/7:A 2gww/2/1:A/5:A 2gww/2/2:A/4:A 2gww/2/3:A/6:A 2hsq/3/12:A/27:A 2hsq/3/1:A/26:A 2hsq/3/25:A/6:A
  • 2hsq/2/16:A/9:A 2hsq/2/10:A/13:A 2hsq/2/11:A/14:A 2hsq/2/12:A/15:A 2hsq/2/17:A/5:A 2hsq/2/18:A/8:A 2hsq/2/19:A/7:A 2hsq/2/1:A/22:A 2hsq/2/20:A/6:A 2hsq/2/21:A/4:A 2hsq/2/24:A/3:A 2hsq/2/2:A/23:A
  • 2hsq/2/23:A/9:A 2hsq/2/10:A/21:A 2hsq/2/10:A/24:A 2hsq/2/11:A/21:A 2hsq/2/11:A/24:A 2hsq/2/12:A/22:A 2hsq/2/12:A/23:A 2hsq/2/13:A/5:A 2hsq/2/13:A/8:A 2hsq/2/14:A/6:A 2hsq/2/14:A/7:A 2hsq/2/15:A/6:A 2hsq/2/15:A/7:A 2hsq/2/16:A/5:A 2hsq/2/16:A/8:A 2hsq/2/17:A/4:A 2hsq/2/18:A/2:A 2hsq/2/18:A/3:A 2hsq/2/19:A/2:A 2hsq/2/19:A/3:A 2hsq/2/1:A/17:A 2hsq/2/1:A/20:A 2hsq/2/20:A/4:A 2hsq/2/22:A/9:A
  • 3tj6/2/2:A/3:A 3tj6/2/1:A/2:A 3tj6/2/1:A/3:A
  • [Back to Home]