2htm/3/1:A/1:D

Sequences

>2htm-a3-m1-cA (length=234) [Search sequence]

MDTWKVGPVELKSRLILGSGKYEDFGVMREAIAAAKAEVVTVSVRRVEGLLEALEGVRLL
PNTAGARTAEEAVRLARLGRLLTGERWVKLEVIPDPTYLLPDPLETLKAAERLIEEDFLV
LPYMGPDLVLAKRLAALGTATVMPLAAPIGSGWGVRTRALLELFAREKASLPPVVVDAGL
GLPSHAAEVMELGLDAVLVNTAIAEAQDPPAMAEAFRLAVEAGRKAYLAGPMRP

>2htm-a3-m1-cD (length=234) [Search sequence]

Structure information

PDB ID	2htm (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of TTHA0676 from Thermus thermophilus HB8
Assembly ID	3
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	63
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	D
UniProt accession	Q5SKG7	Q5SKG7
Species	274 (Thermus thermophilus)	274 (Thermus thermophilus)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2htm-a3-m1-cA_2htm-a3-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2htm-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

2htm/3/1:D/1:C 2htm/1/1:B/1:A 2htm/2/1:D/1:C 2htm/3/1:B/1:A