2hvf/2/1:A/2:A

Sequences
>2hvf-a2-m1-cA (length=51) [Search sequence]
MKVIFLKDVKGKGKKGEIKNVADGYANNFLFKQLAIEATPANLKALEAQKQ
>2hvf-a2-m2-cA (length=51) [Search sequence]
MKVIFLKDVKGKGKKGEIKNVADGYANNFLFKQLAIEATPANLKALEAQKQ
Structure information
PDB ID 2hvf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of N-terminal Domain of Ribosomal Protein L9 (NTL9), G34dA
Assembly ID 2
Resolution 1.57Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 40
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P02417 P02417
Species 1422 (Geobacillus stearothermophilus) 1422 (Geobacillus stearothermophilus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2hvf-a2-m1-cA_2hvf-a2-m2-cA.pdb.gz
Full biological assembly
Download: 2hvf-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2hba/3/3:A/4:A 2hba/3/1:B/2:B
  • 2hba/3/1:B/4:A 2hba/3/2:B/3:A
  • [Back to Home]