2hyn/1/1:D/1:E

Sequences
>2hyn-a1-m1-cD (length=52) [Search sequence]
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
>2hyn-a1-m1-cE (length=52) [Search sequence]
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
Structure information
PDB ID 2hyn (database links: RCSB PDB PDBe PDBj PDBsum)
Title Complete ensemble of NMR structures of unphosphorylated human phospholamban pentamer
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 38
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D E
UniProt accession P26678 P26678
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2hyn-a1-m1-cD_2hyn-a1-m1-cE.pdb.gz
Full biological assembly
Download: 2hyn-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1zll/1/1:A/1:B 1zll/1/1:A/1:E 1zll/1/1:B/1:C 1zll/1/1:C/1:D 1zll/1/1:D/1:E 2hyn/1/1:A/1:B 2hyn/1/1:A/1:E 2hyn/1/1:B/1:C 2hyn/1/1:C/1:D
Other dimers with similar sequences but different poses
  • 2kyv/1/1:D/1:E 2kyv/1/1:A/1:B 2kyv/1/1:A/1:E 2kyv/1/1:B/1:C 2kyv/1/1:C/1:D
  • 2m3b/1/1:D/1:E 2m3b/1/1:A/1:B 2m3b/1/1:A/1:E 2m3b/1/1:B/1:C 2m3b/1/1:C/1:D
  • [Back to Home]