2i3h/6/2:A/2:B

Sequences
>2i3h-a6-m2-cA (length=90) [Search sequence]
GPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRG
DDPWTEHAKWFPGCQFLLRSKGQEYINNIH
>2i3h-a6-m2-cB (length=95) [Search sequence]
GPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRG
DDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL
Structure information
PDB ID 2i3h (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of an ML-IAP/XIAP chimera bound to a 4-mer peptide (AVPW)
Assembly ID 6
Resolution 1.62Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 1.0
PubMed citation 17168540
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession Q96CA5 Q96CA5
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:2i3hA BioLiP:2i3hB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2i3h-a6-m2-cA_2i3h-a6-m2-cB.pdb.gz
Full biological assembly
Download: 2i3h-assembly6.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1tw6/3/1:A/1:B 1tw6/3/2:A/2:B 2i3h/3/1:A/1:B 2i3h/3/2:A/2:B 2i3h/5/1:A/1:B 2i3h/5/2:A/2:B 2i3h/6/1:A/1:B
Other dimers with similar sequences but different poses
  • 1oxn/7/1:A/1:D 1oxn/10/1:A/1:D 1oxn/6/1:A/1:D 1oxn/6/1:B/1:C 1oxn/8/1:B/1:C 1oxq/10/1:A/1:D 1oxq/6/1:A/1:D 1oxq/6/1:B/1:C 1oxq/7/1:A/1:D 1oxq/8/1:B/1:C 1oy7/6/1:A/1:D 1oy7/7/1:B/1:C 3f7g/6/1:A/1:D 3f7g/6/1:B/1:C
  • 1oxn/6/1:D/1:B 1oxn/6/1:A/1:C 1oxq/6/1:A/1:C 1oxq/6/1:D/1:B 3f7g/6/1:A/1:C 3f7g/6/1:D/1:B
  • 1oxq/9/2:E/1:D 1oxn/6/2:E/1:D 1oxn/7/2:E/1:D 1oxn/9/2:E/1:D 1oxq/6/2:E/1:D 1oxq/7/2:E/1:D 1tw6/3/1:A/2:B 2i3h/3/1:A/2:B 2i3h/5/1:A/2:B 2i3h/6/1:A/2:B
  • [Back to Home]