2i3h/7/2:A/1:B

Sequences

>2i3h-a7-m2-cA (length=90) [Search sequence]

GPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRG DDPWTEHAKWFPGCQFLLRSKGQEYINNIH

>2i3h-a7-m1-cB (length=95) [Search sequence]

GPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRG DDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL

Structure information

PDB ID	2i3h (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of an ML-IAP/XIAP chimera bound to a 4-mer peptide (AVPW)
Assembly ID	7
Resolution	1.62Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	32
Sequence identity between the two chains	1.0
PubMed citation	17168540

Chain information

	Chain 1	Chain 2
Model ID	2	1
Chain ID	A	B
UniProt accession	Q96CA5	Q96CA5
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:2i3hA	BioLiP:2i3hB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2i3h-a7-m2-cA_2i3h-a7-m1-cB.pdb.gz

Full biological assembly Download: 2i3h-assembly7.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1tw6/3/2:A/1:B 1tw6/4/2:A/1:B 2i3h/3/2:A/1:B 2i3h/4/2:A/1:B 2i3h/5/2:A/1:B 2i3h/6/2:A/1:B