2i4r/2/2:B/4:B

Sequences
>2i4r-a2-m2-cB (length=77) [Search sequence]
HSHLAVVGDPDFTIGFLAGISDIYEVTSDEEIVKAVEDVLKRDDVGVVIKQEYLKKLPPV
LRREIDEKVEPTFVSVG
>2i4r-a2-m4-cB (length=77) [Search sequence]
HSHLAVVGDPDFTIGFLAGISDIYEVTSDEEIVKAVEDVLKRDDVGVVIKQEYLKKLPPV
LRREIDEKVEPTFVSVG
Structure information
PDB ID 2i4r (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the V-type ATP synthase subunit F from Archaeoglobus fulgidus. NESG target GR52A.
Assembly ID 2
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 28
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 4
Chain ID B B
UniProt accession O29102 O29102
Species 2234 (Archaeoglobus fulgidus) 2234 (Archaeoglobus fulgidus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2i4r-a2-m2-cB_2i4r-a2-m4-cB.pdb.gz
Full biological assembly
Download: 2i4r-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2i4r/2/1:A/2:A 2i4r/2/1:B/3:B 2i4r/2/3:A/4:A
Other dimers with similar sequences but different poses
  • 2i4r/2/4:A/4:B 2i4r/1/1:A/1:B 2i4r/2/1:A/1:B 2i4r/2/2:A/2:B 2i4r/2/3:A/3:B
  • 2i4r/2/3:A/4:B 2i4r/2/1:A/2:B 2i4r/2/1:A/3:B 2i4r/2/2:A/1:B 2i4r/2/2:A/4:B 2i4r/2/3:A/1:B 2i4r/2/4:A/2:B 2i4r/2/4:A/3:B
  • [Back to Home]