2i9p/1/1:C/1:B

Sequences

>2i9p-a1-m1-cC (length=293) [Search sequence]

MPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRI
ITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPV
SGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAIS
MIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGT
TLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLRE

>2i9p-a1-m1-cB (length=296) [Search sequence]

Structure information

PDB ID	2i9p (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
Assembly ID	1
Resolution	2.55Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	45
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	B
UniProt accession	P31937	P31937
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:2i9pC	BioLiP:2i9pB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2i9p-a1-m1-cC_2i9p-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2i9p-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2gf2/3/1:B/1:D 2gf2/3/1:C/1:A 2i9p/1/1:A/1:D
Other dimers with similar sequences but different poses	2gf2/3/1:D/1:A 2gf2/1/1:D/1:A 2gf2/2/1:C/1:B 2gf2/3/1:C/1:B 2i9p/1/1:A/1:B 2i9p/1/1:C/1:D 2gf2/3/1:B/1:A 2i9p/1/1:D/1:B