2ief/1/1:C/1:B

Sequences
>2ief-a1-m1-cC (length=53) [Search sequence]
MYLTLQEWNARQRRPRSLETVRRWVRESRIFPPPVKDGREYLFHESAVKVDLN
>2ief-a1-m1-cB (length=54) [Search sequence]
MYLTLQEWNARQRRPRSLETVRRWVRESRIFPPPVKDGREYLFHESAVKVDLNR
Structure information
PDB ID 2ief (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the cooperative Excisionase (Xis)-DNA complex reveals a micronucleoprotein filament
Assembly ID 1
Resolution 2.601Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 19
Sequence identity between the two chains 1.0
PubMed citation 17287355
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C B
UniProt accession P03699 P03699
Species 10710 (Lambdavirus lambda) 10710 (Lambdavirus lambda)
Function annotation BioLiP:2iefC BioLiP:2iefB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2ief-a1-m1-cC_2ief-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2ief-assembly1.cif.gz
Similar dimers

[Back to Home]