2ij0/1/1:E/1:C

Sequences
>2ij0-a1-m1-cE (length=118) [Search sequence]
GAVVSQHPSMVIVKSGTSVKIECRSLDTNIHTMFWYRQFPKQSLMLMATSHQGFNAIYEQ
GVVKDKFLINHASPTLSTLTVTSAHPEDSGFYVCSALAGSGSSTDTQYFGPGTQLTVL
>2ij0-a1-m1-cC (length=118) [Search sequence]
GAVVSQHPSMVIVKSGTSVKIECRSLDTNIHTMFWYRQFPKQSLMLMATSHQGFNAIYEQ
GVVKDKFLINHASPTLSTLTVTSAHPEDSGFYVCSALAGSGSSTDTQYFGPGTQLTVL
Structure information
PDB ID 2ij0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural basis of T cell specificity and activation by the bacterial superantigen toxic shock syndrome toxin-1
Assembly ID 1
Resolution 2.25Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 34
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E C
UniProt accession A0A5B4 A0A5B4
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2ij0-a1-m1-cE_2ij0-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2ij0-assembly1.cif.gz

[Back to Home]