2ipz/1/1:A/1:D

Sequences
>2ipz-a1-m1-cA (length=34) [Search sequence]
MKVKQLVDKVEELLSKNYHLVNEVARLVKLVGER
>2ipz-a1-m1-cD (length=34) [Search sequence]
MKVKQLVDKVEELLSKNYHLVNEVARLVKLVGER
Structure information
PDB ID 2ipz (database links: RCSB PDB PDBe PDBj PDBsum)
Title A Parallel Coiled-Coil Tetramer with Offset Helices
Assembly ID 1
Resolution 1.35Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A D
UniProt accession P03069 P03069
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2ipz-a1-m1-cA_2ipz-a1-m1-cD.pdb.gz
Full biological assembly
Download: 2ipz-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2ipz/1/1:A/1:B 2ipz/1/1:C/1:D
Other dimers with similar sequences but different poses
  • 2ipz/1/1:B/1:C 2ipz/1/1:A/1:C
  • 2nrn/1/1:C/1:D 2nrn/1/1:A/1:B
  • 3ck4/3/1:I/1:L 3ck4/2/1:H/1:E 3crp/1/1:A/1:D
  • [Back to Home]