2ivm/1/2:A/4:B

Sequences
>2ivm-a1-m2-cA (length=147) [Search sequence]
ALDDIDRILVRELAADGRGTLSELATRAGLSVSAVQSRVRRLESRGVVQGYSARINPEAV
GHLLSAFVAITPLDPSQPDDAPARLEHIEEVESCYSVAGEESYVLLVRVASARALEDLLQ
RIRTTANVRTRSTIILNTFYSDRQHIP
>2ivm-a1-m4-cB (length=147) [Search sequence]
ALDDIDRILVRELAADGRGTLSELATRAGLSVSAVQSRVRRLESRGVVQGYSARINPEAV
GHLLSAFVAITPLDPSQPDDAPARLEHIEEVESCYSVAGEESYVLLVRVASARALEDLLQ
RIRTTANVRTRSTIILNTFYSDRQHIP
Structure information
PDB ID 2ivm (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a transcriptional regulator
Assembly ID 1
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 4
Chain ID A B
UniProt accession P96896 P96896
Species 83332 (Mycobacterium tuberculosis H37Rv) 83332 (Mycobacterium tuberculosis H37Rv)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2ivm-a1-m2-cA_2ivm-a1-m4-cB.pdb.gz
Full biological assembly
Download: 2ivm-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2ivm/1/1:A/2:B 2ivm/1/1:A/3:B 2ivm/1/1:B/2:A 2ivm/1/1:B/3:A 2ivm/1/2:B/4:A 2ivm/1/3:A/4:B 2ivm/1/3:B/4:A 2qz8/1/1:A/1:C 2qz8/1/1:A/2:B 2qz8/1/1:B/1:D 2qz8/1/1:B/2:A 2qz8/1/1:C/2:D 2qz8/1/1:D/2:C 2qz8/1/2:A/2:C 2qz8/1/2:B/2:D 2w24/1/1:A/2:B 2w24/1/1:A/3:B 2w24/1/1:B/2:A 2w24/1/1:B/3:A 2w24/1/2:A/4:B 2w24/1/2:B/4:A 2w24/1/3:A/4:B 2w24/1/3:B/4:A 2w25/1/1:A/2:B 2w25/1/1:A/3:B 2w25/1/1:B/2:A 2w25/1/1:B/3:A 2w25/1/2:A/4:B 2w25/1/2:B/4:A 2w25/1/3:A/4:B 2w25/1/3:B/4:A 2w29/1/1:A/1:D 2w29/1/1:B/1:C 2w29/1/2:A/2:D 2w29/1/2:B/2:C
Other dimers with similar sequences but different poses
  • 2w24/1/4:A/4:B 2ivm/1/1:A/1:B 2ivm/1/2:A/2:B 2ivm/1/3:A/3:B 2ivm/1/4:A/4:B 2qz8/1/1:A/1:D 2qz8/1/1:B/2:B 2qz8/1/1:C/2:C 2qz8/1/2:A/2:D 2vbw/1/1:A/1:B 2vbx/1/1:A/1:B 2vby/1/1:A/1:B 2vbz/1/1:A/1:B 2vc0/1/1:A/1:B 2vc1/1/1:A/1:B 2w24/1/1:A/1:B 2w24/1/2:A/2:B 2w24/1/3:A/3:B 2w25/1/1:A/1:B 2w25/1/2:A/2:B 2w25/1/3:A/3:B 2w25/1/4:A/4:B 2w29/1/1:A/1:B 2w29/1/1:C/1:D 2w29/1/2:A/2:B 2w29/1/2:C/2:D
  • 2w25/1/3:A/4:A 2ivm/1/1:A/2:A 2ivm/1/1:B/3:B 2ivm/1/2:B/4:B 2ivm/1/3:A/4:A 2qz8/1/1:A/2:C 2qz8/1/1:B/2:D 2qz8/1/1:C/2:A 2qz8/1/1:D/2:B 2w24/1/1:A/2:A 2w24/1/1:B/3:B 2w24/1/2:B/4:B 2w24/1/3:A/4:A 2w25/1/1:A/2:A 2w25/1/1:B/3:B 2w25/1/2:B/4:B 2w29/1/1:A/2:A 2w29/1/1:B/1:D 2w29/1/2:B/2:D
  • [Back to Home]