2j05/1/1:B/1:A

Sequences
>2j05-a1-m1-cB (length=57) [Search sequence]
RRRVRAILPYTKVPDTDEISFLKGDFIVHNELEDGWWVTNLRTDEQGLIVEDLVEEV
>2j05-a1-m1-cA (length=61) [Search sequence]
SHRRRVRAILPYTKVPDTDEISFLKGDFIVHNELEDGWWVTNLRTDEQGLIVEDLVEEVG
R
Structure information
PDB ID 2j05 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the RasGAP SH3 domain at 1.5 Angstrom resolution
Assembly ID 1
Resolution 1.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 38
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P20936 P20936
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2j05-a1-m1-cB_2j05-a1-m1-cA.pdb.gz
Full biological assembly
Download: 2j05-assembly1.cif.gz
Similar dimers

[Back to Home]