2j10/1/1:B/1:C |
| >2j10-a1-m1-cB (length=31) [Search sequence] |
| EYFFLKIRGRERFEMFRELNEALELKDAQAG |
| >2j10-a1-m1-cC (length=31) [Search sequence] |
| EYFFLKIRGRERFEMFRELNEALELKDAQAG |
|
| PDB ID |
2j10 (database links:
RCSB PDB
PDBe
PDBj
PDBsum) |
| Title |
p53 tetramerization domain mutant T329F Q331K |
| Assembly ID |
1 |
| Resolution |
Not applicable |
| Method of structure determination |
SOLUTION NMR |
| Number of inter-chain contacts |
20 |
| Sequence identity between the two chains |
1.0 |
|
|
Chain 1 |
Chain 2 |
| Model ID |
1 |
1 |
| Chain ID |
B |
C |
| UniProt accession |
P04637 |
P04637 |
| Species |
9606 (Homo sapiens) |
9606 (Homo sapiens) |
|
Switch viewer: [NGL] [JSmol]
|
Dimer structure:
Chain 1 in red;
Chain 2 in blue.
|
Full biological assembly
|
|
| Other dimers with similar sequences and structures |
2j0z/1/1:A/1:D 2j0z/1/1:B/1:C 2j10/1/1:A/1:D 2j11/1/1:A/1:D 2j11/1/1:B/1:C |
| Other dimers with similar sequences but different poses |
5xzc/2/1:B/1:C 1aie/1/1:A/3:A 1aie/1/2:A/4:A 1c26/1/1:A/4:A 1c26/1/2:A/3:A
3q01/1/1:A/1:B 1aie/1/1:A/4:A 1aie/1/2:A/3:A 2j0z/1/1:A/1:B 2j0z/1/1:C/1:D 2j10/1/1:A/1:B 2j10/1/1:C/1:D 2j11/1/1:A/1:B 2j11/1/1:C/1:D
5xzc/2/1:B/1:D 1c26/1/1:A/3:A 1c26/1/2:A/4:A 1pes/1/1:A/1:B 1pes/1/1:C/1:D 1pet/1/1:A/1:B 1pet/1/1:C/1:D
1pet/1/1:A/1:D 1pes/1/1:A/1:D 1pes/1/1:B/1:C 1pet/1/1:B/1:C
1tup/1/1:B/1:A 1tsr/1/1:B/1:A
5mcv/1/2:A/2:B 1tsr/1/1:B/1:C 1tup/1/1:B/1:C 3kmd/1/1:A/1:D 3kmd/1/1:B/1:C 3kz8/1/1:A/1:B 3kz8/1/2:A/2:B 3q05/1/1:A/1:C 3q05/1/1:B/1:D 3q06/1/1:A/1:C 3q06/1/1:B/1:D 3ts8/1/1:A/1:C 3ts8/1/1:B/1:D 4hje/1/1:A/1:D 4hje/1/1:B/1:C 4mzr/1/1:A/1:C 4mzr/1/1:B/1:D 5lgy/1/1:A/1:C 5lgy/1/1:D/1:B 5mct/1/1:A/1:B 5mct/1/2:A/2:B 5mcu/1/1:A/1:B 5mcu/1/2:A/2:B 5mcv/1/1:A/1:B 5mcw/1/1:A/1:B 5mcw/1/2:A/2:B 5mf7/1/1:A/1:B 5mf7/1/2:A/2:B 5mg7/1/1:A/1:B 5mg7/1/2:A/2:B 5xzc/2/1:D/1:E 6fj5/1/1:A/1:B 6fj5/1/1:C/1:D 7b49/1/1:A/1:B 7b49/1/2:A/2:B 7b4a/1/1:A/1:B 7b4a/1/2:A/2:B 7eeu/1/1:A/1:B 7eeu/1/1:C/1:D 7eeu/2/1:F/1:E 7eeu/2/1:G/1:H 7xzx/1/1:K/1:N 7xzx/1/1:L/1:M 7xzz/1/1:K/1:N 7xzz/1/1:L/1:M
7b4n/1/1:A/2:A 2ac0/1/1:A/1:B 2ac0/1/1:C/1:D 2ady/1/1:A/1:B 2ady/1/2:A/2:B 2ahi/1/1:A/1:B 2ahi/1/1:C/1:D 2ata/1/1:A/1:B 2ata/1/1:C/1:D 3d0a/1/1:A/1:B 3d0a/2/1:C/1:D 3igk/1/1:A/2:A 3igl/1/1:A/2:A 3kmd/1/1:A/1:B 3kmd/1/1:C/1:D 3kz8/1/1:A/2:B 3kz8/1/1:B/2:A 3q05/1/1:A/1:B 3q05/1/1:C/1:D 3q06/1/1:A/1:B 3q06/1/1:C/1:D 3ts8/1/1:A/1:B 3ts8/1/1:C/1:D 4hje/1/1:A/1:B 4hje/1/1:C/1:D 4ibu/1/1:A/1:B 4ibu/1/1:C/1:D 4ibv/1/1:A/2:A 4ibw/1/1:A/2:A 4mzr/1/1:A/1:B 4mzr/1/1:C/1:D 5bua/1/1:A/2:A 5lgy/1/1:A/1:B 5lgy/1/1:C/1:D 5mct/1/1:A/2:B 5mct/1/1:B/2:A 5mcu/1/1:A/2:B 5mcu/1/1:B/2:A 5mcv/1/1:A/2:B 5mcv/1/1:B/2:A 5mcw/1/1:A/2:B 5mcw/1/1:B/2:A 5mf7/1/1:A/2:B 5mf7/1/1:B/2:A 5mg7/1/1:A/2:B 5mg7/1/1:B/2:A 6fj5/1/1:A/1:D 6fj5/1/1:B/1:C 6znc/1/1:A/2:A 7b46/1/1:B/1:A 7b46/1/1:C/1:D 7b49/1/1:A/2:B 7b49/1/1:B/2:A 7b4a/1/1:A/2:B 7b4a/1/1:B/2:A 7b4d/1/1:A/2:A 7b4e/1/1:A/2:A 7b4f/1/1:A/2:A 7b4g/1/1:A/2:A 7b4h/1/1:A/2:A 7eeu/1/1:A/1:C 7eeu/1/1:B/1:D 7eeu/2/1:E/1:G 7eeu/2/1:F/1:H 7xzx/1/1:K/1:L 7xzx/1/1:M/1:N 7xzz/1/1:K/1:L 7xzz/1/1:M/1:N
7b46/1/1:C/1:B 2ac0/1/1:A/1:D 2ac0/1/1:C/1:B 2ady/1/1:A/2:B 2ady/1/2:A/1:B 2ahi/1/1:C/1:B 2ata/1/1:C/1:B 4ibu/1/1:C/1:B
7b4c/1/1:B/1:A 7b47/1/1:A/1:B 7b48/1/1:A/1:B 7b4b/1/1:A/1:B 7ygi/1/1:A/1:B
7b47/1/1:B/1:C 7b47/1/1:D/1:A 7b48/1/1:C/1:B 7b48/1/1:D/1:A 7b4b/1/1:C/1:B 7b4b/1/1:D/1:A 7b4c/1/1:A/1:D 7b4c/1/1:B/1:C |
|