2j2f/3/1:D/1:E

Sequences

>2j2f-a3-m1-cD (length=347) [Search sequence]

PFMPPREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDGF
DEQVRELRERAKEIPDDYFVVLVGDMITEEALPTYQTMLNTLDGVRDETGASPTSWAIWT
RAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLGFIYTSFQE
RADFISHGNTARQAKEHGDIKLAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAFA
DMMRKKISMPAHLMYDGRDDNLFDHFSAVAQRLGVYTAKDYADILEFLVGRWKVDKLTGL
SAEGQKAQDYVCRLPPRIRRLEERAQGRAKEAPTMPFSWIFDRQVKL

>2j2f-a3-m1-cE (length=347) [Search sequence]

Structure information

PDB ID	2j2f (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The T199D Mutant of Stearoyl Acyl Carrier Protein Desaturase from Ricinus Communis (Castor Bean)
Assembly ID	3
Resolution	2.65Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	200
Sequence identity between the two chains	1.0
PubMed citation	17088542

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	E
UniProt accession	P22337	P22337
Species	3988 (Ricinus communis)	3988 (Ricinus communis)
Function annotation	BioLiP:2j2fD	BioLiP:2j2fE

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2j2f-a3-m1-cD_2j2f-a3-m1-cE.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2j2f-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1afr/1/1:A/1:F 1afr/2/1:B/1:C 1afr/3/1:D/1:E 1oq4/1/1:A/1:B 1oq4/2/1:C/1:D 1oq4/3/1:E/1:F 1oq7/1/1:A/1:B 1oq7/2/1:C/1:D 1oq7/3/1:E/1:F 1oq9/1/1:A/2:A 1oqb/1/1:A/1:B 1oqb/2/1:C/1:D 1oqb/3/1:E/1:F 2j2f/1/1:F/1:A 2j2f/2/1:C/1:B 2xz0/1/1:C/2:C 2xz0/2/1:A/1:B 2xz1/1/1:B/1:A 4v0j/1/1:D/1:C 4v0j/2/1:F/1:E 4v0j/3/1:A/1:B