2j4j/1/1:A/1:F

Sequences

>2j4j-a1-m1-cA (length=216) [Search sequence]

MNIILKISGKFFDEDNVDNLIVLRQSIKELADNGFRVGIVTGGGSTARRYIKLAREIGIG
EAYLDLLGIWASRLNAYLVMFSLQDLAYMHVPQSLEEFIQDWSHGKVVVTGGFQPGQSTA
AVAALVAEASSSKTLVVATNVDGVYEKDPRIYADVKLIPHLTTQDLRKILEELLDPLAIK
IVERSKIRVIVMNYRKLNRIIDILKGEEVSSIIEPV

>2j4j-a1-m1-cF (length=226) [Search sequence]

Structure information

PDB ID	2j4j (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of uridylate kinase from Sulfolobus solfataricus in complex with UMP and AMPPCP to 2.1 Angstrom resolution
Assembly ID	1
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	74
Sequence identity between the two chains	1.0
PubMed citation	17297917

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	F
UniProt accession	Q97ZE2	Q97ZE2
Species	273057 (Saccharolobus solfataricus P2)	273057 (Saccharolobus solfataricus P2)
Function annotation	BioLiP:2j4jA	BioLiP:2j4jF

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2j4j-a1-m1-cA_2j4j-a1-m1-cF.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2j4j-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2j4j/1/1:C/1:B 2j4j/1/1:D/1:E 2j4k/1/1:C/1:B 2j4k/1/1:F/1:D 2j4l/1/1:A/1:E 2j4l/1/1:D/1:F 2j4l/2/1:J/1:L 2j4l/2/1:K/1:G
Other dimers with similar sequences but different poses	2j4j/1/1:E/1:F 2j4j/1/1:A/1:B 2j4j/1/1:C/1:D 2j4k/1/1:A/1:B 2j4k/1/1:C/1:D 2j4l/1/1:B/1:A 2j4l/1/1:E/1:F 2j4l/2/1:H/1:G 2j4j/1/1:A/1:E 2j4j/1/1:B/1:D 2j4j/1/1:B/1:F 2j4j/1/1:C/1:A 2j4j/1/1:C/1:E 2j4j/1/1:D/1:F 2j4k/1/1:B/1:D 2j4k/1/1:E/1:D 2j4l/1/1:A/1:F 2j4l/1/1:B/1:D 2j4l/1/1:B/1:E 2j4l/1/1:D/1:E 2j4l/2/1:G/1:L 2j4l/2/1:I/1:G 2j4l/2/1:K/1:J