2j7j/1/1:A/2:A

Sequences
>2j7j-a1-m1-cA (length=85) [Search sequence]
MYVCHFENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHAGYP
CKKDDSCSFVGKTWTLYLKHVAECH
>2j7j-a1-m2-cA (length=85) [Search sequence]
MYVCHFENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHAGYP
CKKDDSCSFVGKTWTLYLKHVAECH
Structure information
PDB ID 2j7j (database links: RCSB PDB PDBe PDBj PDBsum)
Title Invariance of the zinc finger module: a comparison of the free structure with those in nucleic-acid complexes
Assembly ID 1
Resolution 1.65Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 69
Sequence identity between the two chains 1.0
PubMed citation 17335000
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P03001 P03001
Species 8355 (Xenopus laevis) 8355 (Xenopus laevis)
Function annotation BioLiP:2j7jA BioLiP:2j7jA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2j7j-a1-m1-cA_2j7j-a1-m2-cA.pdb.gz
Full biological assembly
Download: 2j7j-assembly1.cif.gz

[Back to Home]