2jo8/1/1:A/1:B

Sequences

>2jo8-a1-m1-cA (length=51) [Search sequence]

GSDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK

>2jo8-a1-m1-cB (length=51) [Search sequence]

GSDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK

Structure information

PDB ID	2jo8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Solution structure of C-terminal domain of human mammalian sterile 20-like kinase 1 (MST1)
Assembly ID	1
Resolution	Not applicable
Method of structure determination	SOLUTION NMR
Number of inter-chain contacts	74
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q13043	Q13043
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2jo8-a1-m1-cA_2jo8-a1-m1-cB.pdb.gz

Full biological assembly Download: 2jo8-assembly1.cif.gz