2jxi/1/1:A/1:B

Sequences
>2jxi-a1-m1-cA (length=45) [Search sequence]
MATTTLGVKLDDPTRERLKAAAQSIDRTPHWLIKQAIFNYLEKLE
>2jxi-a1-m1-cB (length=45) [Search sequence]
MATTTLGVKLDDPTRERLKAAAQSIDRTPHWLIKQAIFNYLEKLE
Structure information
PDB ID 2jxi (database links: RCSB PDB PDBe PDBj PDBsum)
Title Solution structure of the DNA-binding domain of Pseudomonas putida Proline utilization A (putA) bound to GTTGCA DNA sequence
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 89
Sequence identity between the two chains 1.0
PubMed citation 18767154
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q88D80 Q88D80
Species 303 (Pseudomonas putida) 303 (Pseudomonas putida)
Function annotation BioLiP:2jxiA BioLiP:2jxiB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2jxi-a1-m1-cA_2jxi-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2jxi-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2jxg/1/1:A/1:B 2jxh/1/1:A/1:B

[Back to Home]