2k1n/1/1:A/1:B

Sequences

>2k1n-a1-m1-cA (length=55) [Search sequence]

MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQ

>2k1n-a1-m1-cB (length=55) [Search sequence]

MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQ

Structure information

PDB ID	2k1n (database links: RCSB PDB PDBe PDBj PDBsum)
Title	DNA bound structure of the N-terminal domain of AbrB
Assembly ID	1
Resolution	Not applicable
Method of structure determination	SOLUTION NMR
Number of inter-chain contacts	129
Sequence identity between the two chains	1.0
PubMed citation	19000822

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P08874	P08874
Species	1423 (Bacillus subtilis)	1423 (Bacillus subtilis)
Function annotation	BioLiP:2k1nA	BioLiP:2k1nB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2k1n-a1-m1-cA_2k1n-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2k1n-assembly1.cif.gz