2k1n/1/1:A/1:D

Sequences
>2k1n-a1-m1-cA (length=55) [Search sequence]
MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQ
>2k1n-a1-m1-cD (length=55) [Search sequence]
MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQ
Structure information
PDB ID 2k1n (database links: RCSB PDB PDBe PDBj PDBsum)
Title DNA bound structure of the N-terminal domain of AbrB
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 10
Sequence identity between the two chains 1.0
PubMed citation 19000822
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A D
UniProt accession P08874 P08874
Species 1423 (Bacillus subtilis) 1423 (Bacillus subtilis)
Function annotation BioLiP:2k1nA BioLiP:2k1nD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2k1n-a1-m1-cA_2k1n-a1-m1-cD.pdb.gz
Full biological assembly
Download: 2k1n-assembly1.cif.gz

[Back to Home]