2k6l/1/1:A/1:B

Sequences
>2k6l-a1-m1-cA (length=51) [Search sequence]
MNTVRWNIAVSPDVDQSVRMFIAAQGGGRKGDLSRFIEDAVRAYLFERAVE
>2k6l-a1-m1-cB (length=51) [Search sequence]
MNTVRWNIAVSPDVDQSVRMFIAAQGGGRKGDLSRFIEDAVRAYLFERAVE
Structure information
PDB ID 2k6l (database links: RCSB PDB PDBe PDBj PDBsum)
Title The solution structure of XACb0070 from Xanthonomas axonopodis pv citri reveals this new protein is a member of the RHH family of transcriptional repressors
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 91
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q8NL33 Q8NL33
Species
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2k6l-a1-m1-cA_2k6l-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2k6l-assembly1.cif.gz

[Back to Home]