2kel/1/1:A/1:B

Sequences
>2kel-a1-m1-cA (length=46) [Search sequence]
KQKAVFGIYMDKDLKTRLKVYCAKNNLQLTQAIEEAIKEYLQKRNG
>2kel-a1-m1-cB (length=46) [Search sequence]
KQKAVFGIYMDKDLKTRLKVYCAKNNLQLTQAIEEAIKEYLQKRNG
Structure information
PDB ID 2kel (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the transcription regulator SvtR from the hyperthermophilic archaeal virus SIRV1
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 137
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q8QL46 Q8QL46
Species 157898 (Sulfolobus islandicus rod-shaped virus 1) 157898 (Sulfolobus islandicus rod-shaped virus 1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2kel-a1-m1-cA_2kel-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2kel-assembly1.cif.gz

[Back to Home]