2ki6/1/1:C/1:D

Sequences
>2ki6-a1-m1-cC (length=96) [Search sequence]
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKM
KSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIR
>2ki6-a1-m1-cD (length=97) [Search sequence]
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKM
KSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLIRKK
Structure information
PDB ID 2ki6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title The FGF1-S100A13-C2A hetero-hexameric complex structure: A component in the non-classical pathway for FGF1 secretion
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 44
Sequence identity between the two chains 0.99
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession Q99584 Q99584
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2ki6-a1-m1-cC_2ki6-a1-m1-cD.pdb.gz
Full biological assembly
Download: 2ki6-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2k8m/1/1:B/1:C 2ki4/1/1:B/1:C 2l5x/1/1:B/1:C 2le9/1/1:B/1:C
Other dimers with similar sequences but different poses
  • 1yus/1/1:A/1:B 1yur/1/1:A/1:B
  • 1yut/1/1:A/1:B 1yuu/1/1:A/1:B 2kot/1/1:A/1:B
  • [Back to Home]