2kn7/1/1:A/1:D

Sequences

>2kn7-a1-m1-cA (length=67) [Search sequence]

EKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFI HTSFAEV

>2kn7-a1-m1-cD (length=67) [Search sequence]

EKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFI HTSFAEV

Structure information

PDB ID	2kn7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the XPF-single strand DNA complex
Assembly ID	1
Resolution	Not applicable
Method of structure determination	SOLUTION NMR
Number of inter-chain contacts	82
Sequence identity between the two chains	1.0
PubMed citation	22483113

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	D
UniProt accession	Q92889	Q92889
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:2kn7A	BioLiP:2kn7D

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2kn7-a1-m1-cA_2kn7-a1-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2kn7-assembly1.cif.gz

Similar dimers