2ko8/1/1:B/1:C

Sequences
>2ko8-a1-m1-cB (length=52) [Search sequence]
VIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK
>2ko8-a1-m1-cC (length=52) [Search sequence]
VIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK
Structure information
PDB ID 2ko8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title The Structure of Anti-TRAP
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 32
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession O31466 O31466
Species 1423 (Bacillus subtilis) 1423 (Bacillus subtilis)
Function annotation BioLiP:2ko8B BioLiP:2ko8C
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2ko8-a1-m1-cB_2ko8-a1-m1-cC.pdb.gz
Full biological assembly
Download: 2ko8-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2ko8/1/1:A/1:B 2ko8/1/1:A/1:C
Other dimers with similar sequences but different poses
  • 2zp8/1/3:I/3:J 2bx9/1/1:A/1:B 2bx9/1/1:A/1:C 2bx9/1/1:B/1:C 2bx9/1/1:D/1:E 2bx9/1/1:D/1:F 2bx9/1/1:E/1:F 2bx9/1/1:G/1:H 2bx9/1/1:G/1:I 2bx9/1/1:H/1:I 2bx9/1/1:J/1:K 2bx9/1/1:J/1:L 2bx9/1/1:K/1:L 2zp8/1/1:E/1:F 2zp8/1/1:E/1:G 2zp8/1/1:F/1:G 2zp8/1/1:H/1:I 2zp8/1/1:H/1:J 2zp8/1/1:I/1:J 2zp8/1/2:E/2:F 2zp8/1/2:E/2:G 2zp8/1/2:F/2:G 2zp8/1/2:H/2:I 2zp8/1/2:H/2:J 2zp8/1/2:I/2:J 2zp8/1/3:E/3:F 2zp8/1/3:E/3:G 2zp8/1/3:F/3:G 2zp8/1/3:H/3:I 2zp8/1/3:H/3:J
  • 2bx9/1/1:F/1:K 2bx9/1/1:A/1:I 2bx9/1/1:B/1:D 2bx9/1/1:C/1:J 2bx9/1/1:E/1:H 2bx9/1/1:G/1:L
  • 2zp8/1/2:E/3:J 2zp8/1/1:E/2:J 2zp8/1/1:G/1:H 2zp8/1/1:J/3:E 2zp8/1/2:G/2:H 2zp8/1/3:G/3:H 2zp9/2/6:C/5:E 2zp9/2/7:C/1:E 2zp9/2/8:C/4:E
  • [Back to Home]