2kp8/1/1:B/1:C

Sequences
>2kp8-a1-m1-cB (length=72) [Search sequence]
TSLIHSLIEESQNQQEKNEQELLELDGDGPQLLSGIVQQQNNLLRAIEAQQHLLQLTVWG
IKQLQARILAVE
>2kp8-a1-m1-cC (length=72) [Search sequence]
TSLIHSLIEESQNQQEKNEQELLELDGDGPQLLSGIVQQQNNLLRAIEAQQHLLQLTVWG
IKQLQARILAVE
Structure information
PDB ID 2kp8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Ligand bound to a model peptide that mimics the open fusogenic form
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 82
Sequence identity between the two chains 1.0
PubMed citation 20004576
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession
Species 562 (Escherichia coli) 562 (Escherichia coli)
Function annotation BioLiP:2kp8B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2kp8-a1-m1-cB_2kp8-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2kp8-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2kp8/1/1:A/1:B 2kp8/1/1:A/1:C

[Back to Home]