2l35/1/1:B/1:A

Sequences

>2l35-a1-m1-cB (length=32) [Search sequence]

CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR

>2l35-a1-m1-cA (length=63) [Search sequence]

CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFL EQN

Structure information

PDB ID	2l35 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the DAP12-NKG2C transmembrane heterotrimer
Assembly ID	1
Resolution	Not applicable
Method of structure determination	SOLUTION NMR
Number of inter-chain contacts	76
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	O43914	P26717
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2l35-a1-m1-cB_2l35-a1-m1-cA.pdb.gz

Full biological assembly Download: 2l35-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

4wo1/2/1:B/1:C 4wo1/1/1:A/1:D 4wol/1/1:B/1:C 4wol/1/1:B/1:A 4wol/1/1:C/1:A