2l9u/1/1:A/1:B

Sequences
>2l9u-a1-m1-cA (length=40) [Search sequence]
MGRTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRHHHHHH
>2l9u-a1-m1-cB (length=40) [Search sequence]
MGRTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRHHHHHH
Structure information
PDB ID 2l9u (database links: RCSB PDB PDBe PDBj PDBsum)
Title Spatial structure of dimeric ErbB3 transmembrane domain
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P21860 P21860
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2l9u-a1-m1-cA_2l9u-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2l9u-assembly1.cif.gz

[Back to Home]