2ljb/1/1:C/1:D

Sequences
>2ljb-a1-m1-cC (length=30) [Search sequence]
SDPLVVAASIIGILHFIAWTIGHLNQIKRG
>2ljb-a1-m1-cD (length=30) [Search sequence]
SDPLVVAASIIGILHFIAWTIGHLNQIKRG
Structure information
PDB ID 2ljb (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the influenza AM2-BM2 chimeric channel
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 21
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession B4UQM4 B4UQM4
Species 529646 (Influenza B virus (B/Taiwan/70061/2006)) 529646 (Influenza B virus (B/Taiwan/70061/2006))
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2ljb-a1-m1-cC_2ljb-a1-m1-cD.pdb.gz
Full biological assembly
Download: 2ljb-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2ljb/1/1:A/1:B 2ljb/1/1:A/1:D 2ljb/1/1:B/1:C 2ljc/1/1:A/1:D 2ljc/1/1:B/1:C 2ljc/1/1:C/1:D

[Back to Home]