2ljc/1/1:A/1:B

Sequences
>2ljc-a1-m1-cA (length=30) [Search sequence]
SDPLVVAASIIGILHFIAWTIGHLNQIKRG
>2ljc-a1-m1-cB (length=30) [Search sequence]
SDPLVVAASIIGILHFIAWTIGHLNQIKRG
Structure information
PDB ID 2ljc (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the influenza AM2-BM2 chimeric channel bound to rimantadine
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 35
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession B4UQM4 B4UQM4
Species 529646 (Influenza B virus (B/Taiwan/70061/2006)) 529646 (Influenza B virus (B/Taiwan/70061/2006))
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2ljc-a1-m1-cA_2ljc-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2ljc-assembly1.cif.gz

[Back to Home]