2llt/1/1:A/1:B

Sequences

>2llt-a1-m1-cA (length=92) [Search sequence]

GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKE LDENGDGEVDFQEYVVLVAALTVANNFFWENS

>2llt-a1-m1-cB (length=92) [Search sequence]

GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKE LDENGDGEVDFQEYVVLVAALTVANNFFWENS

Structure information

PDB ID	2llt (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Post-translational S-nitrosylation is an endogenous factor fine-tuning human S100A1 protein properties
Assembly ID	1
Resolution	Not applicable
Method of structure determination	SOLUTION NMR
Number of inter-chain contacts	100
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P23297	P23297
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2llt-a1-m1-cA_2llt-a1-m1-cB.pdb.gz

Full biological assembly Download: 2llt-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2l0p/1/1:A/1:B 2lhl/1/1:A/1:B 2lls/1/1:A/1:B 2llu/1/1:A/1:B 2m3w/1/1:A/1:B
Other dimers with similar sequences but different poses	5k89/2/1:H/3:H 1zfs/1/1:A/1:B 2k2f/1/1:A/1:B 2kbm/1/1:A/1:B 2lp2/1/1:A/1:B 2lp3/1/1:A/1:B 2lux/1/1:A/1:B