2lme/1/1:B/1:C

Sequences
>2lme-a1-m1-cB (length=105) [Search sequence]
GDQASWSHPQFEKGAHKFRQLDNRLDKLDTRVDKGLASSAALNSLFQPYGVGKVNFTAGV
GGYRSSQALAIGSGYRVNESVALKAGVAYAGSSDVMYNASFNIEW
>2lme-a1-m1-cC (length=105) [Search sequence]
GDQASWSHPQFEKGAHKFRQLDNRLDKLDTRVDKGLASSAALNSLFQPYGVGKVNFTAGV
GGYRSSQALAIGSGYRVNESVALKAGVAYAGSSDVMYNASFNIEW
Structure information
PDB ID 2lme (database links: RCSB PDB PDBe PDBj PDBsum)
Title Solid-state NMR structure of the membrane anchor domain of the trimeric autotransporter YadA
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLID-STATE NMR
Number of inter-chain contacts 111
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession A1JUB7 A1JUB7
Species 393305 (Yersinia enterocolitica subsp. enterocolitica 8081) 393305 (Yersinia enterocolitica subsp. enterocolitica 8081)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2lme-a1-m1-cB_2lme-a1-m1-cC.pdb.gz
Full biological assembly
Download: 2lme-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2lme/1/1:A/1:B 2lme/1/1:A/1:C

[Back to Home]