2lo0/1/1:A/1:B

Sequences
>2lo0-a1-m1-cA (length=45) [Search sequence]
PSGESVVATEAFWDDLQGFLEQRLKDYDEANKLRVLFKEAWRSSF
>2lo0-a1-m1-cB (length=45) [Search sequence]
PSGESVVATEAFWDDLQGFLEQRLKDYDEANKLRVLFKEAWRSSF
Structure information
PDB ID 2lo0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Solution structure of the Get5 carboxyl domain from A. fumigatus
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 77
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q4WE50 Q4WE50
Species 330879 (Aspergillus fumigatus Af293) 330879 (Aspergillus fumigatus Af293)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2lo0-a1-m1-cA_2lo0-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2lo0-assembly1.cif.gz

[Back to Home]