2lr6/1/1:A/1:B

Sequences
>2lr6-a1-m1-cA (length=88) [Search sequence]
GVLMDEGAVLTLAADLSSATLDISKQWSNVFNILRENDFEPKFLCEVKLAFKCDGEIKTF
SDLQSLRKFASQKSSMKELLKDVLPQKE
>2lr6-a1-m1-cB (length=88) [Search sequence]
GVLMDEGAVLTLAADLSSATLDISKQWSNVFNILRENDFEPKFLCEVKLAFKCDGEIKTF
SDLQSLRKFASQKSSMKELLKDVLPQKE
Structure information
PDB ID 2lr6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title NMR structure of a LINE-1 type transposase domain-containing protein 1 (L1TD1) from Homo sapiens
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 126
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q5T7N2 Q5T7N2
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2lr6-a1-m1-cA_2lr6-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2lr6-assembly1.cif.gz

[Back to Home]