2lyl/1/1:A/1:B

Sequences
>2lyl-a1-m1-cA (length=66) [Search sequence]
MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDI
FQWQPE
>2lyl-a1-m1-cB (length=66) [Search sequence]
MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDI
FQWQPE
Structure information
PDB ID 2lyl (database links: RCSB PDB PDBe PDBj PDBsum)
Title NOE-based 3D structure of the predissociated homodimer of CylR2 in equilibrium with monomer at 266K (-7 Celsius degrees)
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 48
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q8VL32 Q8VL32
Species 1351 (Enterococcus faecalis) 1351 (Enterococcus faecalis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2lyl-a1-m1-cA_2lyl-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2lyl-assembly1.cif.gz

[Back to Home]