2m3b/1/1:D/1:E

Sequences
>2m3b-a1-m1-cD (length=51) [Search sequence]
MEKVQYLTRSAIRRATIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL
>2m3b-a1-m1-cE (length=51) [Search sequence]
MEKVQYLTRSAIRRATIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL
Structure information
PDB ID 2m3b (database links: RCSB PDB PDBe PDBj PDBsum)
Title Serine 16 phosphorylated phospholamban pentamer, Hybrid solution and solid-state NMR structural ensemble
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR, SOLID-STATE NMR
Number of inter-chain contacts 50
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D E
UniProt accession P61015 P61015
Species 9986 (Oryctolagus cuniculus) 9986 (Oryctolagus cuniculus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2m3b-a1-m1-cD_2m3b-a1-m1-cE.pdb.gz
Full biological assembly
Download: 2m3b-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2m3b/1/1:A/1:B 2m3b/1/1:A/1:E 2m3b/1/1:B/1:C 2m3b/1/1:C/1:D
Other dimers with similar sequences but different poses
  • 2hyn/1/1:D/1:E 1zll/1/1:A/1:B 1zll/1/1:A/1:E 1zll/1/1:B/1:C 1zll/1/1:C/1:D 1zll/1/1:D/1:E 2hyn/1/1:A/1:B 2hyn/1/1:A/1:E 2hyn/1/1:B/1:C 2hyn/1/1:C/1:D
  • 2kyv/1/1:D/1:E 2kyv/1/1:A/1:B 2kyv/1/1:A/1:E 2kyv/1/1:B/1:C 2kyv/1/1:C/1:D
  • [Back to Home]